Halaman

Rabu

Nama-nama Terpanjang di Dunia

1. Nama Orang Terpanjang di Dunia (27 kata)

Autumn Sullivan Corbett Fitzsimmons Jeffries Hart Burns Johnson Willard Dempsey Tunney Schmeling Sharkey Carnera Baer Braddock Louis Charles Walcott Marciano Patterson Johansson Liston Clay Frazier Foreman Brown merupakan nama seorang anak di Inggris. Namanya yang terdiri dari 27 kata diatas diambil dari 25 nama petinju top dari seluruh dunia dan 2 sisanya adalah nama depan dan nama keluarganya.

2. Nama Desa Terpanjang (58 huruf)


Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch merupakan sebuah desa di pulau Anglesey di Wales, Britania Raya. Desa ini tercatat dalam Guiness Book of Record sebagai tempat dengan nama desa terpanjang di Britania.

3. Nama Bukit Terpanjang (85 huruf)


Taumatawhakatangihangakoauauotamateaturipukakapikimaungahoronukupokaiwhe-nuakitanatahu adalah nama sebuah bukit di Porangahau, di selatan Waipukurau di selatan Hawke’s Bay, Selandia Baru. Nama ini biasanya disingkat jadi Taumata (karena terlalu panjang tentunya)

4. Nama Tempat Terpanjang

Krungthepmahanakonbowornratanakosinmahintarayudyayamahadilopo-noparatanarajthaniburiromudomrajniweshasatarnamornpimarnavatarsatitsakattiyavisa-nukamphrasit merupakan nama suatu tempat di Thailand.

5. Nama Domain dan Nama Kota Terpanjang


http://www.llanfairpwllgwyngyllgogerychw…och.co.uk/ merupakan situs untuk mempromosikan sebuah kota di Anglesey, Gwynedd, Inggris. Nama kotanya itu sama seperti nama situsnya. 58 untuk nama kotanya, 7 karakter untuk .org.uk (tapi sudah diganti menjadi .co.uk), dan...

6. Alamat E-mail Terpanjang


yourname@abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijk.com,
nama yang sangat panjang untuk sebuah email address, kalau mau ngecek lihat saja di sini

7. Nama Album Terpanjang (19 kata)


She Who Dwells in the Secret Place of the Most High Shall Abide Under the Shadow of the Almighty adalah nama sebuah album yang dirilis oleh mantan penyanyi SinĂ©ad O’Connor pada tahun 2003.

Tidak ada komentar:

Posting Komentar

Silahkan Berkomentar =D

Ada kesalahan di dalam gadget ini
Related Posts with Thumbnails